Lineage for d1zalb_ (1zal B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (33 PDB entries)
  8. Domain d1zalb_: 1zal B: [124837]
    automated match to d1adoa_
    complexed with po4

Details for d1zalb_

PDB Entry: 1zal (more details), 1.8900000000000001 Å

PDB Description: fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with partially disordered tagatose-1,6-bisphosphate, a weak competitive inhibitor
PDB Compounds: (B:) Fructose-bisphosphate aldolase A

SCOPe Domain Sequences for d1zalb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zalb_ c.1.10.1 (B:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
hay

SCOPe Domain Coordinates for d1zalb_ are not available.

Timeline for d1zalb_:

Domains from other chains:
(mouse over for more information)
d1zala_, d1zalc_, d1zald_