Class a: All alpha proteins [46456] (290 folds) |
Fold a.251: Phage replication organizer domain [140712] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) DNA binding induces further oligomerization automatically mapped to Pfam PF06720 |
Family a.251.1.1: Phage replication organizer domain [140714] (2 proteins) Pfam PF06720 |
Protein automated matches [190518] (1 species) not a true protein |
Species Bacillus phage [TaxId:10756] [187475] (4 PDB entries) |
Domain d1zaeb2: 1zae B:63-130 [124823] Other proteins in same PDB: d1zaea3, d1zaeb3 automated match to d2c5ra1 |
PDB Entry: 1zae (more details)
SCOPe Domain Sequences for d1zaeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zaeb2 a.251.1.1 (B:63-130) automated matches {Bacillus phage [TaxId: 10756]} dktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqk klyrgslk
Timeline for d1zaeb2: