SCOPe 2.08: Domain d1zaea2: 1zae A:63-130

Lineage for d1zaea2 (1zae A:63-130)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.251.1: Phage replication organizer domain [140713] (1 family)
   DNA binding induces further oligomerization
   automatically mapped to Pfam PF06720

5. Family a.251.1.1: Phage replication organizer domain [140714] (2 proteins)
   Pfam PF06720

6. Protein automated matches [190518] (1 species)
   not a true protein

7. Species Bacillus phage [TaxId:10756] [187475] (4 PDB entries)

8. Domain d1zaea2: 1zae A:63-130 [124822]
   Other proteins in same PDB: d1zaea3, d1zaeb3
   automated match to d2c5ra1

Details for d1zaea2

PDB Entry: 1zae

PDB Description: solution structure of the functional domain of phi29 replication organizer p16.7c

PDB Compounds: (A:) early protein gp16.7

SCOPe Domain Sequences for d1zaea2:

Sequence; same for both SEQRES and ATOM records:

>d1zaea2 a.251.1.1 (A:63-130) automated matches {Bacillus phage [TaxId: 10756]}
dktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqk
klyrgslk

Timeline for d1zaea2:

• d1zaea2 first appeared in SCOP 1.73, called d1zaea1
  
• d1zaea2 appears in SCOPe 2.07