Lineage for d1zaea2 (1zae A:63-130)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016099Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2016100Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) (S)
    DNA binding induces further oligomerization
    automatically mapped to Pfam PF06720
  5. 2016101Family a.251.1.1: Phage replication organizer domain [140714] (2 protein domains)
    Pfam PF06720
  6. 2016105Protein automated matches [190518] (1 species)
    not a true protein
  7. 2016106Species Bacillus phage [TaxId:10756] [187475] (4 PDB entries)
  8. 2016116Domain d1zaea2: 1zae A:63-130 [124822]
    Other proteins in same PDB: d1zaea3, d1zaeb3
    automated match to d2c5ra1

Details for d1zaea2

PDB Entry: 1zae (more details)

PDB Description: Solution structure of the functional domain of phi29 replication organizer p16.7c
PDB Compounds: (A:) early protein gp16.7

SCOPe Domain Sequences for d1zaea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaea2 a.251.1.1 (A:63-130) automated matches {Bacillus phage [TaxId: 10756]}
dktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqk
klyrgslk

SCOPe Domain Coordinates for d1zaea2:

Click to download the PDB-style file with coordinates for d1zaea2.
(The format of our PDB-style files is described here.)

Timeline for d1zaea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zaea3