Lineage for d1z90b1 (1z90 B:384-468)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962569Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962570Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 962682Family b.81.1.4: GlmU C-terminal domain-like [51171] (3 proteins)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 962720Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [141581] (1 species)
  7. 962721Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141582] (4 PDB entries)
    Uniprot Q9M9P3 384-469
  8. 962729Domain d1z90b1: 1z90 B:384-468 [124734]
    Other proteins in same PDB: d1z90a2, d1z90b2
    automatically matched to 1Z90 A:384-469

Details for d1z90b1

PDB Entry: 1z90 (more details), 1.86 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g03250, a putative udp-glucose pyrophosphorylase
PDB Compounds: (B:) AT3g03250 protein

SCOPe Domain Sequences for d1z90b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z90b1 b.81.1.4 (B:384-468) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssivlkgkvtva
aksgvkleipdravvenkningped

SCOPe Domain Coordinates for d1z90b1:

Click to download the PDB-style file with coordinates for d1z90b1.
(The format of our PDB-style files is described here.)

Timeline for d1z90b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z90b2