Class b: All beta proteins [48724] (174 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.4: GlmU C-terminal domain-like [51171] (3 proteins) this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain |
Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [141581] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141582] (4 PDB entries) Uniprot Q9M9P3 384-469 |
Domain d1z90b1: 1z90 B:384-468 [124734] Other proteins in same PDB: d1z90a2, d1z90b2 automatically matched to 1Z90 A:384-469 |
PDB Entry: 1z90 (more details), 1.86 Å
SCOPe Domain Sequences for d1z90b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z90b1 b.81.1.4 (B:384-468) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssivlkgkvtva aksgvkleipdravvenkningped
Timeline for d1z90b1: