SCOPe 2.08: Domain d1z90b1: 1z90 B:384-468

Lineage for d1z90b1 (1z90 B:384-468)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [141581] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141582] (4 PDB entries)
   Uniprot Q9M9P3 384-469

8. Domain d1z90b1: 1z90 B:384-468 [124734]
   Other proteins in same PDB: d1z90a2, d1z90b2
   automated match to d1z90a1
   has additional insertions and/or extensions that are not grouped together

Details for d1z90b1

PDB Entry: 1z90, 1.86 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g03250, a putative udp-glucose pyrophosphorylase

PDB Compounds: (B:) AT3g03250 protein

SCOPe Domain Sequences for d1z90b1:

Sequence; same for both SEQRES and ATOM records:

>d1z90b1 b.81.1.4 (B:384-468) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssivlkgkvtva
aksgvkleipdravvenkningped

Timeline for d1z90b1:

• d1z90b1 first appeared in SCOP 1.73
  
• d1z90b1 appears in SCOPe 2.07