SCOPe 2.04: Domain d1z8ma1: 1z8m A:1-88

Lineage for d1z8ma1 (1z8m A:1-88)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.2: RelE-like [143015] (3 proteins)
   Pfam PF05016

6. Protein Hypothetical protein HP0894 [143018] (1 species)

7. Species Helicobacter pylori [TaxId:210] [143019] (1 PDB entry)
   Uniprot O25554 1-88

8. Domain d1z8ma1: 1z8m A:1-88 [124718]

Details for d1z8ma1

PDB Entry: 1z8m

PDB Description: Solution structure of the conserved hypothtical protein HP0894 from Helicobacter pylori

PDB Compounds: (A:) conserved hypothetical protein HP0894

SCOPe Domain Sequences for d1z8ma1:

Sequence; same for both SEQRES and ATOM records:

>d1z8ma1 d.298.1.2 (A:1-88) Hypothetical protein HP0894 {Helicobacter pylori [TaxId: 210]}
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvllvylvkddelillrlgshself

Timeline for d1z8ma1:

• d1z8ma1 first appeared in SCOP 1.73
  
• d1z8ma1 appears in SCOPe 2.03
  
• d1z8ma1 appears in SCOPe 2.05
  
• d1z8ma1 appears in the current release, SCOPe 2.08