Lineage for d1z8ma1 (1z8m A:1-88)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947487Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 1947488Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 1947504Family d.298.1.2: RelE-like [143015] (3 proteins)
    Pfam PF05016
  6. 1947505Protein Hypothetical protein HP0894 [143018] (1 species)
  7. 1947506Species Helicobacter pylori [TaxId:210] [143019] (1 PDB entry)
    Uniprot O25554 1-88
  8. 1947507Domain d1z8ma1: 1z8m A:1-88 [124718]

Details for d1z8ma1

PDB Entry: 1z8m (more details)

PDB Description: Solution structure of the conserved hypothtical protein HP0894 from Helicobacter pylori
PDB Compounds: (A:) conserved hypothetical protein HP0894

SCOPe Domain Sequences for d1z8ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8ma1 d.298.1.2 (A:1-88) Hypothetical protein HP0894 {Helicobacter pylori [TaxId: 210]}
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvllvylvkddelillrlgshself

SCOPe Domain Coordinates for d1z8ma1:

Click to download the PDB-style file with coordinates for d1z8ma1.
(The format of our PDB-style files is described here.)

Timeline for d1z8ma1: