Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.4: PA domain [52025] (1 family) |
Family c.8.4.1: PA domain [52026] (2 proteins) |
Protein Glutamate carboxypeptidase II [141984] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141985] (34 PDB entries) Uniprot Q04609 118-350 |
Domain d1z8ld2: 1z8l D:118-350 [124716] Other proteins in same PDB: d1z8la1, d1z8la3, d1z8lb1, d1z8lb3, d1z8lc1, d1z8lc3, d1z8ld1, d1z8ld3 automatically matched to 2C6C A:118-350 complexed with nag, zn |
PDB Entry: 1z8l (more details), 3.5 Å
SCOPe Domain Sequences for d1z8ld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8ld2 c.8.4.1 (D:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn
Timeline for d1z8ld2: