![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
![]() | Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) ![]() automatically mapped to Pfam PF04253 |
![]() | Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins) |
![]() | Protein Glutamate carboxypeptidase II [140574] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140575] (34 PDB entries) Uniprot Q04609 594-750 |
![]() | Domain d1z8lc1: 1z8l C:594-750 [124712] Other proteins in same PDB: d1z8la2, d1z8la3, d1z8lb2, d1z8lb3, d1z8lc2, d1z8lc3, d1z8ld2, d1z8ld3 automatically matched to 2C6C A:594-750 complexed with nag, zn |
PDB Entry: 1z8l (more details), 3.5 Å
SCOPe Domain Sequences for d1z8lc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8lc1 a.48.2.1 (C:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf dieskvdpskawgevkrqiyvaaftvqaaaetlseva
Timeline for d1z8lc1: