SCOPe 2.08: Domain d1z8ga2: 1z8g A:50-159

Lineage for d1z8ga2 (1z8g A:50-159)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.170: SRCR-like [56486] (2 superfamilies)
   unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta

4. Superfamily d.170.1: SRCR-like [56487] (3 families)

5. Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein)
   automatically mapped to Pfam PF09272

6. Protein Hepsin, N-terminal domain [103356] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103357] (4 PDB entries)
   Uniprot P05981 50-159

8. Domain d1z8ga2: 1z8g A:50-159 [124698]
   Other proteins in same PDB: d1z8ga1
   automatically matched to d1o5el_

Details for d1z8ga2

PDB Entry: 1z8g, 1.55 Å

PDB Description: crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate.

PDB Compounds: (A:) Serine protease hepsin

SCOPe Domain Sequences for d1z8ga2:

Sequence; same for both SEQRES and ATOM records:

>d1z8ga2 d.170.1.2 (A:50-159) Hepsin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp

Timeline for d1z8ga2:

• d1z8ga2 first appeared in SCOP 1.73
  
• d1z8ga2 appears in SCOPe 2.07