![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.170: SRCR-like [56486] (2 superfamilies) unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta |
![]() | Superfamily d.170.1: SRCR-like [56487] (2 families) ![]() |
![]() | Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein) |
![]() | Protein Hepsin, N-terminal domain [103356] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103357] (4 PDB entries) |
![]() | Domain d1z8ga2: 1z8g A:50-159 [124698] Other proteins in same PDB: d1z8ga1 automatically matched to d1o5el_ complexed with ace, mai; mutant |
PDB Entry: 1z8g (more details), 1.55 Å
SCOP Domain Sequences for d1z8ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8ga2 d.170.1.2 (A:50-159) Hepsin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
Timeline for d1z8ga2: