Lineage for d1z8ga2 (1z8g A:50-159)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2608706Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 2608707Superfamily d.170.1: SRCR-like [56487] (3 families) (S)
  5. 2608712Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein)
    automatically mapped to Pfam PF09272
  6. 2608713Protein Hepsin, N-terminal domain [103356] (1 species)
  7. 2608714Species Human (Homo sapiens) [TaxId:9606] [103357] (4 PDB entries)
    Uniprot P05981 50-159
  8. 2608715Domain d1z8ga2: 1z8g A:50-159 [124698]
    Other proteins in same PDB: d1z8ga1
    automatically matched to d1o5el_

Details for d1z8ga2

PDB Entry: 1z8g (more details), 1.55 Å

PDB Description: Crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate.
PDB Compounds: (A:) Serine protease hepsin

SCOPe Domain Sequences for d1z8ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8ga2 d.170.1.2 (A:50-159) Hepsin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp

SCOPe Domain Coordinates for d1z8ga2:

Click to download the PDB-style file with coordinates for d1z8ga2.
(The format of our PDB-style files is described here.)

Timeline for d1z8ga2: