Class b: All beta proteins [48724] (180 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins) |
Protein Polymyxin resistance protein ArnA, domain 2 [141381] (1 species) |
Species Escherichia coli [TaxId:562] [141382] (4 PDB entries) Uniprot P77398 201-304! Uniprot P77398 204-304 |
Domain d1z7ef1: 1z7e F:201-304 [124621] Other proteins in same PDB: d1z7ea2, d1z7ea3, d1z7eb2, d1z7eb3, d1z7ec2, d1z7ec3, d1z7ed2, d1z7ed3, d1z7ee2, d1z7ee3, d1z7ef2, d1z7ef3 automated match to d1z7ea1 complexed with atp, uga |
PDB Entry: 1z7e (more details), 3 Å
SCOPe Domain Sequences for d1z7ef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ef1 b.46.1.1 (F:201-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]} rtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvi svaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrl
Timeline for d1z7ef1: