| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein Polymyxin resistance protein ArnA (PrmI) [117419] (1 species) evolved new activities: UDP-glucuronic acid decarboxylase, UDP-4-amino-4-deoxy-L-arabinose formyltransferase |
| Species Escherichia coli [TaxId:562] [117420] (8 PDB entries) Uniprot P77398 |
| Domain d1z7ea2: 1z7e A:314-656 [124607] Other proteins in same PDB: d1z7ea1, d1z7ea3, d1z7eb1, d1z7eb3, d1z7ec1, d1z7ec3, d1z7ed1, d1z7ed3, d1z7ee1, d1z7ee3, d1z7ef1, d1z7ef3 complexed with atp, uga has additional subdomain(s) that are not in the common domain |
PDB Entry: 1z7e (more details), 3 Å
SCOPe Domain Sequences for d1z7ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ea2 c.2.1.2 (A:314-656) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}
rrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihs
ewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpsts
evygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnw
mgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriien
agnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgy
qdvehrkpsirnahrcldwepkidmqetidetldfflrtvdlt
Timeline for d1z7ea2: