Lineage for d1z7ef3 (1z7e F:1-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892512Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2892596Protein Polymyxin resistance protein ArnA, N-terminal domain [142569] (1 species)
  7. 2892597Species Escherichia coli [TaxId:562] [142570] (4 PDB entries)
    Uniprot P77398 1-200! Uniprot P77398 1-203
  8. 2892606Domain d1z7ef3: 1z7e F:1-200 [124623]
    Other proteins in same PDB: d1z7ea1, d1z7ea2, d1z7eb1, d1z7eb2, d1z7ec1, d1z7ec2, d1z7ed1, d1z7ed2, d1z7ee1, d1z7ee2, d1z7ef1, d1z7ef2
    automated match to d1z7ea3
    complexed with atp, uga

Details for d1z7ef3

PDB Entry: 1z7e (more details), 3 Å

PDB Description: Crystal structure of full length ArnA
PDB Compounds: (F:) protein ArnA

SCOPe Domain Sequences for d1z7ef3:

Sequence, based on SEQRES records: (download)

>d1z7ef3 c.65.1.1 (F:1-200) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
khgnileiaqreneatcfgr

Sequence, based on observed residues (ATOM records): (download)

>d1z7ef3 c.65.1.1 (F:1-200) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdgsvarlaaergipvyapdnvnhplwv
eriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvngetet
gvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnilei
aqreneatcfgr

SCOPe Domain Coordinates for d1z7ef3:

Click to download the PDB-style file with coordinates for d1z7ef3.
(The format of our PDB-style files is described here.)

Timeline for d1z7ef3: