SCOPe 2.06: Domain d1z67a1: 1z67 A:3-131

Lineage for d1z67a1 (1z67 A:3-131)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.259: YidB-like [140803] (1 superfamily)
   multihelical; three strings of short helices are packed across one longer helix

4. Superfamily a.259.1: YidB-like [140804] (1 family)
   automatically mapped to Pfam PF06078

5. Family a.259.1.1: YidB-like [140805] (1 protein)
   Pfam PF06078; DUF937

6. Protein Hypothetical protein YidB [140806] (1 species)

7. Species Shigella flexneri [TaxId:623] [140807] (1 PDB entry)
   Uniprot Q83IZ7 3-131
   SF3766, S4005

8. Domain d1z67a1: 1z67 A:3-131 [124507]
   complexed with na

Details for d1z67a1

PDB Entry: 1z67, 1.45 Å

PDB Description: Structure of Homeodomain-like Protein of Unknown Function S4005 from Shigella flexneri

PDB Compounds: (A:) hypothetical protein S4005

SCOPe Domain Sequences for d1z67a1:

Sequence, based on SEQRES records:

>d1z67a1 a.259.1.1 (A:3-131) Hypothetical protein YidB {Shigella flexneri [TaxId: 623]}
lfdevvgaflkgdagkyqailswveeqggiqvlleklqsgglgailstwlsnqqrnqsvs
geqlesalgtnavsdlgqklgvdtstassllaeqlpkiidalspqgevsaqanndllsag
mellkgklf

Sequence, based on observed residues (ATOM records):

>d1z67a1 a.259.1.1 (A:3-131) Hypothetical protein YidB {Shigella flexneri [TaxId: 623]}
lfdevvgaflkgdagkyqailswveeqggiqvlleklqsgglgailstwlsnqqrnqsvs
geqlesalgtnavsdlgqklgvdtstassllaeqlpkiidalspqgevqanndllsagme
llkgklf

Timeline for d1z67a1:

• d1z67a1 first appeared in SCOP 1.73
  
• d1z67a1 appears in SCOPe 2.05
  
• d1z67a1 appears in SCOPe 2.07
  
• d1z67a1 appears in the current release, SCOPe 2.08