Lineage for d1z67a1 (1z67 A:3-131)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738410Fold a.259: YidB-like [140803] (1 superfamily)
    multihelical; three strings of short helices are packed across one longer helix
  4. 2738411Superfamily a.259.1: YidB-like [140804] (1 family) (S)
    automatically mapped to Pfam PF06078
  5. 2738412Family a.259.1.1: YidB-like [140805] (1 protein)
    Pfam PF06078; DUF937
  6. 2738413Protein Hypothetical protein YidB [140806] (1 species)
  7. 2738414Species Shigella flexneri [TaxId:623] [140807] (1 PDB entry)
    Uniprot Q83IZ7 3-131
    SF3766, S4005
  8. 2738415Domain d1z67a1: 1z67 A:3-131 [124507]
    complexed with na

Details for d1z67a1

PDB Entry: 1z67 (more details), 1.45 Å

PDB Description: Structure of Homeodomain-like Protein of Unknown Function S4005 from Shigella flexneri
PDB Compounds: (A:) hypothetical protein S4005

SCOPe Domain Sequences for d1z67a1:

Sequence, based on SEQRES records: (download)

>d1z67a1 a.259.1.1 (A:3-131) Hypothetical protein YidB {Shigella flexneri [TaxId: 623]}
lfdevvgaflkgdagkyqailswveeqggiqvlleklqsgglgailstwlsnqqrnqsvs
geqlesalgtnavsdlgqklgvdtstassllaeqlpkiidalspqgevsaqanndllsag
mellkgklf

Sequence, based on observed residues (ATOM records): (download)

>d1z67a1 a.259.1.1 (A:3-131) Hypothetical protein YidB {Shigella flexneri [TaxId: 623]}
lfdevvgaflkgdagkyqailswveeqggiqvlleklqsgglgailstwlsnqqrnqsvs
geqlesalgtnavsdlgqklgvdtstassllaeqlpkiidalspqgevqanndllsagme
llkgklf

SCOPe Domain Coordinates for d1z67a1:

Click to download the PDB-style file with coordinates for d1z67a1.
(The format of our PDB-style files is described here.)

Timeline for d1z67a1: