Lineage for d1z63b1 (1z63 B:432-661)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597279Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 1597340Protein Helicase of the SNF2/Rad54 hamily [142312] (1 species)
  7. 1597341Species Sulfolobus solfataricus [TaxId:2287] [142313] (3 PDB entries)
    Uniprot Q97XQ7 432-661! Uniprot Q97XQ7 662-802! Uniprot Q97XQ7 663-802
  8. 1597346Domain d1z63b1: 1z63 B:432-661 [124504]
    automatically matched to 1Z63 A:432-661
    protein/DNA complex

Details for d1z63b1

PDB Entry: 1z63 (more details), 3 Å

PDB Description: sulfolobus solfataricus swi2/snf2 atpase core in complex with dsdna
PDB Compounds: (B:) Helicase of the snf2/rad54 hamily

SCOPe Domain Sequences for d1z63b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z63b1 c.37.1.19 (B:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}
fqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqtiavfsdakkene
ltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiilttyavllrdtrl
kevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvddlwsimtflnpg
llgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiindlp

SCOPe Domain Coordinates for d1z63b1:

Click to download the PDB-style file with coordinates for d1z63b1.
(The format of our PDB-style files is described here.)

Timeline for d1z63b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z63b2