SCOP 1.73: Domain d1z63b1: 1z63 B:432-661

Lineage for d1z63b1 (1z63 B:432-661)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Helicase of the SNF2/Rad54 hamily [142312] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [142313] (3 PDB entries)

8. Domain d1z63b1: 1z63 B:432-661 [124504]
   automatically matched to 1Z63 A:432-661

Details for d1z63b1

PDB Entry: 1z63, 3 Å

PDB Description: sulfolobus solfataricus swi2/snf2 atpase core in complex with dsdna

PDB Compounds: (B:) Helicase of the snf2/rad54 hamily

SCOP Domain Sequences for d1z63b1:

Sequence; same for both SEQRES and ATOM records:

>d1z63b1 c.37.1.19 (B:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}
fqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqtiavfsdakkene
ltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiilttyavllrdtrl
kevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvddlwsimtflnpg
llgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiindlp

Timeline for d1z63b1:

• d1z63b1 is new in SCOP 1.73
  
• d1z63b1 appears in SCOP 1.75
  
• d1z63b1 appears in the current release, SCOPe 2.08