![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family) ![]() |
![]() | Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (1 protein) |
![]() | Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [74866] (5 PDB entries) |
![]() | Domain d1z5yd1: 1z5y D:8-125 [124497] Other proteins in same PDB: d1z5ye1 automatically matched to d1se1a1 complexed with cl, edo; mutant |
PDB Entry: 1z5y (more details), 1.94 Å
SCOP Domain Sequences for d1z5yd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5yd1 b.1.17.1 (D:8-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]} rsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhe defygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevvan
Timeline for d1z5yd1: