SCOP 1.73: Domain d1z5yd1: 1z5y D:8-125

Lineage for d1z5yd1 (1z5y D:8-125)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (1 protein)

6. Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species)

7. Species Escherichia coli [TaxId:562] [74866] (5 PDB entries)

8. Domain d1z5yd1: 1z5y D:8-125 [124497]
   Other proteins in same PDB: d1z5ye1
   automatically matched to d1se1a1
   complexed with cl, edo; mutant

Details for d1z5yd1

PDB Entry: 1z5y, 1.94 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg

PDB Compounds: (D:) Thiol:disulfide interchange protein dsbD

SCOP Domain Sequences for d1z5yd1:

Sequence; same for both SEQRES and ATOM records:

>d1z5yd1 b.1.17.1 (D:8-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
rsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhe
defygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevvan

Timeline for d1z5yd1:

• d1z5yd1 is new in SCOP 1.73
  
• d1z5yd1 appears in SCOP 1.75
  
• d1z5yd1 appears in the current release, SCOPe 2.08, called d1z5yd_