Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
Protein Thioredoxin-like protein CcmG (CycY, DsbE) [75237] (2 species) |
Species Escherichia coli [TaxId:562] [142370] (1 PDB entry) |
Domain d1z5ye1: 1z5y E:49-184 [124498] Other proteins in same PDB: d1z5yd1 complexed with cl, edo; mutant |
PDB Entry: 1z5y (more details), 1.94 Å
SCOP Domain Sequences for d1z5ye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} rlesldnpgqfyqadvltqgkpvllnvwatwcptsraehqylnqlsaqgirvvgmnykdd rqkaiswlkelgnpyalslfdgdgmlgldlgvygapetflidgngiiryrhagdlnprvw eeeikplwekyskeaa
Timeline for d1z5ye1: