SCOPe 2.08: Domain d1z5yd_: 1z5y D:

Lineage for d1z5yd_ (1z5y D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)

7. Species Escherichia coli [TaxId:562] [74866] (6 PDB entries)

8. Domain d1z5yd_: 1z5y D: [124497]
   Other proteins in same PDB: d1z5ye1
   automated match to d1vrsa1
   complexed with cl, edo

Details for d1z5yd_

PDB Entry: 1z5y, 1.94 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg

PDB Compounds: (D:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1z5yd_:

Sequence; same for both SEQRES and ATOM records:

>d1z5yd_ b.1.17.1 (D:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
rsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhe
defygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevvan

Timeline for d1z5yd_:

• d1z5yd_ first appeared in SCOP 1.73, called d1z5yd1
  
• d1z5yd_ appears in SCOPe 2.07