SCOP 1.75: Domain d1z5lc1: 1z5l C:186-279

Lineage for d1z5lc1 (1z5l C:186-279)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein CD1, alpha-3 domain [88615] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88616] (7 PDB entries)

8. Domain d1z5lc1: 1z5l C:186-279 [124483]
   Other proteins in same PDB: d1z5la2, d1z5lb1, d1z5lc2, d1z5ld1
   automatically matched to d1cd1a1
   complexed with nag, pbs, r16

Details for d1z5lc1

PDB Entry: 1z5l, 2.2 Å

PDB Description: structure of a highly potent short-chain galactosyl ceramide agonist bound to cd1d

PDB Compounds: (C:) T-cell surface glycoprotein CD1d antigen

SCOP Domain Sequences for d1z5lc1:

Sequence, based on SEQRES records:

>d1z5lc1 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d1z5lc1 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvphghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylq
atldveageeaglacrvkhsslggqdiilyw

Timeline for d1z5lc1:

• d1z5lc1 first appeared in SCOP 1.73
  
• d1z5lc1 appears in SCOPe 2.01
  
• d1z5lc1 appears in the current release, SCOPe 2.08