SCOPe 2.08: Domain d1z5lc1: 1z5l C:186-279

Lineage for d1z5lc1 (1z5l C:186-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d1z5lc1: 1z5l C:186-279 [124483]
   Other proteins in same PDB: d1z5la2, d1z5lb_, d1z5lc2, d1z5ld_
   automated match to d1onqa1
   complexed with nag, pbs, r16

Details for d1z5lc1

PDB Entry: 1z5l, 2.2 Å

PDB Description: structure of a highly potent short-chain galactosyl ceramide agonist bound to cd1d

PDB Compounds: (C:) T-cell surface glycoprotein CD1d antigen

SCOPe Domain Sequences for d1z5lc1:

Sequence, based on SEQRES records:

>d1z5lc1 b.1.1.0 (C:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d1z5lc1 b.1.1.0 (C:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvphghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylq
atldveageeaglacrvkhsslggqdiilyw

Timeline for d1z5lc1:

• d1z5lc1 first appeared in SCOP 1.73
  
• d1z5lc1 appears in SCOPe 2.07