Lineage for d1z5lc1 (1z5l C:186-279)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932610Protein CD1, alpha-3 domain [88615] (4 species)
  7. 932626Species Mouse (Mus musculus) [TaxId:10090] [88616] (7 PDB entries)
  8. 932633Domain d1z5lc1: 1z5l C:186-279 [124483]
    Other proteins in same PDB: d1z5la2, d1z5lb_, d1z5lc2, d1z5ld_
    automatically matched to d1cd1a1
    complexed with nag, pbs, r16

Details for d1z5lc1

PDB Entry: 1z5l (more details), 2.2 Å

PDB Description: structure of a highly potent short-chain galactosyl ceramide agonist bound to cd1d
PDB Compounds: (C:) T-cell surface glycoprotein CD1d antigen

SCOPe Domain Sequences for d1z5lc1:

Sequence, based on SEQRES records: (download)

>d1z5lc1 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d1z5lc1 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvphghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylq
atldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d1z5lc1:

Click to download the PDB-style file with coordinates for d1z5lc1.
(The format of our PDB-style files is described here.)

Timeline for d1z5lc1: