Lineage for d1z3ha1 (1z3h A:2-959)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006372Protein Exportin Cse1p [116998] (1 species)
  7. 2006373Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116999] (2 PDB entries)
    Uniprot P33307
  8. 2006375Domain d1z3ha1: 1z3h A:2-959 [124404]
    complexed with mg

Details for d1z3ha1

PDB Entry: 1z3h (more details), 3.1 Å

PDB Description: The exportin Cse1 in its cargo-free, cytoplasmic state
PDB Compounds: (A:) importin alpha re-exporter

SCOPe Domain Sequences for d1z3ha1:

Sequence, based on SEQRES records: (download)

>d1z3ha1 a.118.1.1 (A:2-959) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalff
knfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdrw
ptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapflnl
lktvdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkyls
ysnplledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsisn
qpkydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfeddp
ieyirrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwkf
kdlyiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaiky
iytfrnqltkaqlielmpilatflqtdeyvvytyaaitiekiltiresntspafifhked
isnsteillknlialilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfie
ivtimaknpsnprfthytfesigailnytqrqnlpllvdsmmptfltvfsediqefipyv
fqiiafvveqsatipesikplaqpllapnvwelkgnipavtrllksfiktdssifpdlvp
vlgifqrliaskayevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvkk
ltvffglisnklgsdflihfidevqdglfqqiwgnfiittlptignlldrkialigvlnm
vingqffqskyptlisstmnsiietassqsianlkndyvdldnleeistfgshfsklvsi
sekpfdplpeidvnngvrlyvaealnkynaisgntflntilpqltqenqvklnqllvg

Sequence, based on observed residues (ATOM records): (download)

>d1z3ha1 a.118.1.1 (A:2-959) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalff
knfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdrw
ptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapflnl
lktvdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkyls
ysnplledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsisn
qpkydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfeddp
ieyirrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwkf
kdlyiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaiky
iytfrnqltkaqlielmpilatflqtdeyvvytyaaitiekiltiressnsteillknli
alilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfieivtimaknpsnpr
fthytfesigailnytqrqnlpllvdsmmptfltvfsediqefipyvfqiiafvveqsat
ipesikplaqpllapnvwelkgnipavtrllksfiktdssifpdlvpvlgifqrliaska
yevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvkkltvffglisnklg
sdflihfidevqdglfqqiwgnfiittlptignlldrkialigvlnmvingqffqskypt
lisstmnsiietassqsgshfsklvsisekpfdplpeidvnngvrlyvaealnkynaisg
ntflntilpqltqenqvklnqllvg

SCOPe Domain Coordinates for d1z3ha1:

Click to download the PDB-style file with coordinates for d1z3ha1.
(The format of our PDB-style files is described here.)

Timeline for d1z3ha1: