SCOPe 2.08: Domain d1z1za1: 1z1z A:2-130

Lineage for d1z1za1 (1z1z A:2-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.323: Phage tail protein-like [143748] (1 superfamily)
   alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel

4. Superfamily d.323.1: Phage tail protein-like [143749] (2 families)
   Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel)

5. Family d.323.1.1: Lambda phage gpU-like [143750] (2 proteins)
   Pfam PF06141

6. Protein Minor tail protein gpU [143751] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [143752] (1 PDB entry)
   Uniprot P03732 2-130

8. Domain d1z1za1: 1z1z A:2-130 [124366]

Details for d1z1za1

PDB Entry: 1z1z

PDB Description: nmr structure of the gpu tail protein from lambda bacteriophage

PDB Compounds: (A:) Minor tail protein U

SCOPe Domain Sequences for d1z1za1:

Sequence; same for both SEQRES and ATOM records:

>d1z1za1 d.323.1.1 (A:2-130) Minor tail protein gpU {Bacteriophage lambda [TaxId: 10710]}
khtelraavldalekhdtgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqae
lhievflpaqvpdseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwssa
dltyvitye

Timeline for d1z1za1:

• d1z1za1 first appeared in SCOP 1.73
  
• d1z1za1 appears in SCOPe 2.07