PDB entry 1z1z

View 1z1z on RCSB PDB site
Description: NMR structure of the gpu tail protein from lambda bacteriophage
Class: viral protein
Keywords: mixed alpha-beta, tail protein, bacteriophage, VIRAL PROTEIN
Deposited on 2005-03-07, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Minor tail protein U
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: gpu
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z1za1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z1zA (A:)
    mkhtelraavldalekhdtgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqa
    elhievflpaqvpdseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwss
    adltyvityem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1zA (A:)
    khtelraavldalekhdtgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqae
    lhievflpaqvpdseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwssa
    dltyvitye