Lineage for d1z1za1 (1z1z A:2-130)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741833Fold d.323: Phage tail protein-like [143748] (1 superfamily)
    alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel
  4. 741834Superfamily d.323.1: Phage tail protein-like [143749] (2 families) (S)
    Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel)
  5. 741835Family d.323.1.1: Lambda phage gpU-like [143750] (1 protein)
    Pfam PF06141
  6. 741836Protein Minor tail protein gpU [143751] (1 species)
  7. 741837Species Bacteriophage lambda [TaxId:10710] [143752] (1 PDB entry)
  8. 741838Domain d1z1za1: 1z1z A:2-130 [124366]

Details for d1z1za1

PDB Entry: 1z1z (more details)

PDB Description: nmr structure of the gpu tail protein from lambda bacteriophage
PDB Compounds: (A:) Minor tail protein U

SCOP Domain Sequences for d1z1za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1za1 d.323.1.1 (A:2-130) Minor tail protein gpU {Bacteriophage lambda [TaxId: 10710]}
khtelraavldalekhdtgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqae
lhievflpaqvpdseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwssa
dltyvitye

SCOP Domain Coordinates for d1z1za1:

Click to download the PDB-style file with coordinates for d1z1za1.
(The format of our PDB-style files is described here.)

Timeline for d1z1za1: