Lineage for d1z1va1 (1z1v A:33-102)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 916791Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 916832Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 916896Protein Ste50p, N-terminal domain [101244] (1 species)
  7. 916897Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101245] (2 PDB entries)
  8. 916898Domain d1z1va1: 1z1v A:33-102 [124365]
    automatically matched to d1uqva_

Details for d1z1va1

PDB Entry: 1z1v (more details)

PDB Description: nmr structure of the saccharomyces cerevisiae ste50 sam domain
PDB Compounds: (A:) ste50 protein

SCOPe Domain Sequences for d1z1va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1va1 a.60.1.2 (A:33-102) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcdgdlnkaikf
kilinkmrds

SCOPe Domain Coordinates for d1z1va1:

Click to download the PDB-style file with coordinates for d1z1va1.
(The format of our PDB-style files is described here.)

Timeline for d1z1va1: