Lineage for d1z1va_ (1z1v A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715540Protein Ste50p, N-terminal domain [101244] (1 species)
  7. 2715541Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101245] (2 PDB entries)
  8. 2715542Domain d1z1va_: 1z1v A: [124365]
    automated match to d1uqva_

Details for d1z1va_

PDB Entry: 1z1v (more details)

PDB Description: nmr structure of the saccharomyces cerevisiae ste50 sam domain
PDB Compounds: (A:) ste50 protein

SCOPe Domain Sequences for d1z1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1va_ a.60.1.2 (A:) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcdgdlnkaikf
kilinkmrds

SCOPe Domain Coordinates for d1z1va_:

Click to download the PDB-style file with coordinates for d1z1va_.
(The format of our PDB-style files is described here.)

Timeline for d1z1va_: