SCOPe 2.08: Domain d1z1gc2: 1z1g C:177-355

Lineage for d1z1gc2 (1z1g C:177-355)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)

6. Protein Integrase (Int) [56353] (2 species)

7. Species Bacteriophage lambda [TaxId:10710] [56354] (5 PDB entries)

8. Domain d1z1gc2: 1z1g C:177-355 [124358]
   Other proteins in same PDB: d1z1ga1, d1z1gb1, d1z1gc1, d1z1gd1
   automatically matched to d1ae9a_
   protein/DNA complex

Details for d1z1gc2

PDB Entry: 1z1g, 4.4 Å

PDB Description: crystal structure of a lambda integrase tetramer bound to a holliday junction

PDB Compounds: (C:) integrase

SCOPe Domain Sequences for d1z1gc2:

Sequence; same for both SEQRES and ATOM records:

>d1z1gc2 d.163.1.1 (C:177-355) Integrase (Int) {Bacteriophage lambda [TaxId: 10710]}
rsrltadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqskt
gvkiaiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkas
glsfegdpptfhelrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkiei

Timeline for d1z1gc2:

• d1z1gc2 first appeared in SCOP 1.73
  
• d1z1gc2 appears in SCOPe 2.07