SCOPe 2.08: Domain d1z1gb1: 1z1g B:11-59

Lineage for d1z1gb1 (1z1g B:11-59)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.10: DNA-binding domain [54170] (1 superfamily)
   beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.10.1: DNA-binding domain [54171] (5 families)

5. Family d.10.1.4: lambda integrase N-terminal domain [75344] (1 protein)

6. Protein lambda integrase N-terminal domain [75345] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [75346] (3 PDB entries)

8. Domain d1z1gb1: 1z1g B:11-59 [124355]
   Other proteins in same PDB: d1z1ga2, d1z1gb2, d1z1gc2, d1z1gd2
   automatically matched to d1kjka_
   protein/DNA complex

Details for d1z1gb1

PDB Entry: 1z1g, 4.4 Å

PDB Description: crystal structure of a lambda integrase tetramer bound to a holliday junction

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d1z1gb1:

Sequence; same for both SEQRES and ATOM records:

>d1z1gb1 d.10.1.4 (B:11-59) lambda integrase N-terminal domain {Bacteriophage lambda [TaxId: 10710]}
dlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsgh

Timeline for d1z1gb1:

• d1z1gb1 first appeared in SCOP 1.73
  
• d1z1gb1 appears in SCOPe 2.07