![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Transcriptional regulator EF0787 [140897] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [140898] (1 PDB entry) Uniprot Q837P6 72-220 |
![]() | Domain d1z0xb2: 1z0x B:72-214 [124337] Other proteins in same PDB: d1z0xa1, d1z0xb1 automated match to d1z0xa2 complexed with cl |
PDB Entry: 1z0x (more details), 2.4 Å
SCOPe Domain Sequences for d1z0xb2:
Sequence, based on SEQRES records: (download)
>d1z0xb2 a.121.1.1 (B:72-214) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} gewysdllafmenyydlyqqfpcavaieiqtvpaypqrlrhlnqmmgilreagfspemth lavtslqhllfgmimdateekqlvsqvlngddylkeqvlhmkqyvsdneltymeesiqfr hsihqksafiqavktyldglqad
>d1z0xb2 a.121.1.1 (B:72-214) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} gewysdllafmenyydlyqqfpcavaieiqtvpaypqrlrhlnqmmgilreagfspemth lavtslqhllfgmimdateekqlvsqvlngddylkeqvlhmkqyvsdneltymeesiqfr ihqksafiqavktyldglqad
Timeline for d1z0xb2: