Lineage for d1z0xb2 (1z0x B:72-214)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008412Protein Transcriptional regulator EF0787 [140897] (1 species)
  7. 2008413Species Enterococcus faecalis [TaxId:1351] [140898] (1 PDB entry)
    Uniprot Q837P6 72-220
  8. 2008415Domain d1z0xb2: 1z0x B:72-214 [124337]
    Other proteins in same PDB: d1z0xa1, d1z0xb1
    automated match to d1z0xa2
    complexed with cl

Details for d1z0xb2

PDB Entry: 1z0x (more details), 2.4 Å

PDB Description: Crystal structure of transcriptional regulator, tetR Family from Enterococcus faecalis V583
PDB Compounds: (B:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d1z0xb2:

Sequence, based on SEQRES records: (download)

>d1z0xb2 a.121.1.1 (B:72-214) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]}
gewysdllafmenyydlyqqfpcavaieiqtvpaypqrlrhlnqmmgilreagfspemth
lavtslqhllfgmimdateekqlvsqvlngddylkeqvlhmkqyvsdneltymeesiqfr
hsihqksafiqavktyldglqad

Sequence, based on observed residues (ATOM records): (download)

>d1z0xb2 a.121.1.1 (B:72-214) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]}
gewysdllafmenyydlyqqfpcavaieiqtvpaypqrlrhlnqmmgilreagfspemth
lavtslqhllfgmimdateekqlvsqvlngddylkeqvlhmkqyvsdneltymeesiqfr
ihqksafiqavktyldglqad

SCOPe Domain Coordinates for d1z0xb2:

Click to download the PDB-style file with coordinates for d1z0xb2.
(The format of our PDB-style files is described here.)

Timeline for d1z0xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z0xb1