Lineage for d1z0xa1 (1z0x A:4-71)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981838Protein Transcriptional regulator EF0787 [140183] (1 species)
  7. 1981839Species Enterococcus faecalis [TaxId:1351] [140184] (1 PDB entry)
    Uniprot Q837P6 4-71
  8. 1981840Domain d1z0xa1: 1z0x A:4-71 [124334]
    Other proteins in same PDB: d1z0xa2, d1z0xb2
    complexed with cl

Details for d1z0xa1

PDB Entry: 1z0x (more details), 2.4 Å

PDB Description: Crystal structure of transcriptional regulator, tetR Family from Enterococcus faecalis V583
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d1z0xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]}
klskdtiiaaafslleksptleqlsmrkvakqlgvqapaiywyfknkqallqsmaeaiee
hfqepalc

SCOPe Domain Coordinates for d1z0xa1:

Click to download the PDB-style file with coordinates for d1z0xa1.
(The format of our PDB-style files is described here.)

Timeline for d1z0xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z0xa2