Lineage for d1z0aa1 (1z0a A:2-170)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867429Protein Rab2a [142265] (1 species)
  7. 2867430Species Human (Homo sapiens) [TaxId:9606] [142266] (1 PDB entry)
    Uniprot P61019 2-170
  8. 2867431Domain d1z0aa1: 1z0a A:2-170 [124307]
    Other proteins in same PDB: d1z0ab_, d1z0ac_, d1z0ad_
    complexed with gdp, mg

Details for d1z0aa1

PDB Entry: 1z0a (more details), 2.12 Å

PDB Description: GDP-Bound Rab2A GTPase
PDB Compounds: (A:) Ras-related protein Rab-2A

SCOPe Domain Sequences for d1z0aa1:

Sequence, based on SEQRES records: (download)

>d1z0aa1 c.37.1.8 (A:2-170) Rab2a {Human (Homo sapiens) [TaxId: 9606]}
ayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqiklqiwd
tagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignks
dlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek

Sequence, based on observed residues (ATOM records): (download)

>d1z0aa1 c.37.1.8 (A:2-170) Rab2a {Human (Homo sapiens) [TaxId: 9606]}
ayaylfkyiiigdtgvgksclllqftdkrfqdltigvefgarmitidgkqiklqiwdtag
qesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignksdle
srrevkkeegeafarehglifmetsaktasnveeafintakeiyek

SCOPe Domain Coordinates for d1z0aa1:

Click to download the PDB-style file with coordinates for d1z0aa1.
(The format of our PDB-style files is described here.)

Timeline for d1z0aa1: