![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab2a [142265] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142266] (1 PDB entry) Uniprot P61019 2-170 |
![]() | Domain d1z0aa1: 1z0a A:2-170 [124307] Other proteins in same PDB: d1z0ab_, d1z0ac_, d1z0ad_ complexed with gdp, mg |
PDB Entry: 1z0a (more details), 2.12 Å
SCOPe Domain Sequences for d1z0aa1:
Sequence, based on SEQRES records: (download)
>d1z0aa1 c.37.1.8 (A:2-170) Rab2a {Human (Homo sapiens) [TaxId: 9606]} ayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqiklqiwd tagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignks dlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek
>d1z0aa1 c.37.1.8 (A:2-170) Rab2a {Human (Homo sapiens) [TaxId: 9606]} ayaylfkyiiigdtgvgksclllqftdkrfqdltigvefgarmitidgkqiklqiwdtag qesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignksdle srrevkkeegeafarehglifmetsaktasnveeafintakeiyek
Timeline for d1z0aa1: