![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.63: ROK associated domain [140279] (3 proteins) found N-terminal to ROK domain in some proteins |
![]() | Protein Transcriptional regulator VC2007 N-terminal domain [140284] (1 species) |
![]() | Species Vibrio cholerae [TaxId:666] [140285] (1 PDB entry) Uniprot Q9KQJ1 10-80 |
![]() | Domain d1z05a1: 1z05 A:10-80 [124298] Other proteins in same PDB: d1z05a2, d1z05a3 complexed with bme, gol, so4, zn |
PDB Entry: 1z05 (more details), 2 Å
SCOPe Domain Sequences for d1z05a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} dhikqinagrvyklidqkgpisridlskeselapasitkitrelidahlihettvqeais rgrpavglqtn
Timeline for d1z05a1: