Lineage for d1z05a1 (1z05 A:10-80)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722689Family a.4.5.63: ROK associated domain [140279] (3 proteins)
    found N-terminal to ROK domain in some proteins
  6. 1722701Protein Transcriptional regulator VC2007 N-terminal domain [140284] (1 species)
  7. 1722702Species Vibrio cholerae [TaxId:666] [140285] (1 PDB entry)
    Uniprot Q9KQJ1 10-80
  8. 1722703Domain d1z05a1: 1z05 A:10-80 [124298]
    Other proteins in same PDB: d1z05a2, d1z05a3
    complexed with bme, gol, so4, zn

Details for d1z05a1

PDB Entry: 1z05 (more details), 2 Å

PDB Description: crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
PDB Compounds: (A:) transcriptional regulator, ROK family

SCOPe Domain Sequences for d1z05a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]}
dhikqinagrvyklidqkgpisridlskeselapasitkitrelidahlihettvqeais
rgrpavglqtn

SCOPe Domain Coordinates for d1z05a1:

Click to download the PDB-style file with coordinates for d1z05a1.
(The format of our PDB-style files is described here.)

Timeline for d1z05a1: