SCOP 1.73: Domain d1yzhb1: 1yzh B:8-211

Lineage for d1yzhb1 (1yzh B:8-211)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.53: TrmB-like [142647] (1 protein)
   Pfam PF02390

6. Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [142649] (1 PDB entry)

8. Domain d1yzhb1: 1yzh B:8-211 [124278]
   automatically matched to 1YZH A:8-211
   complexed with gol

Details for d1yzhb1

PDB Entry: 1yzh, 2.02 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Protein, Methyltransferase from Streptococcus pneumoniae TIGR4

PDB Compounds: (B:) tRNA (guanine-N(7)-)-methyltransferase

SCOP Domain Sequences for d1yzhb1:

Sequence; same for both SEQRES and ATOM records:

>d1yzhb1 c.66.1.53 (B:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]}
gatelleanpqyvvlnpleakakwrdlfgndnpihvevgsgkgafvsgmakqnpdinyig
idiqksvlsyaldkvlevgvpnikllwvdgsdltdyfedgeidrlylnfsdpwpkkrhek
rrltyktfldtfkrilpengeihfktdnrglfeyslvsfsqygmklngvwldlhasdfeg
nvmteyeqkfsnkgqviyrveaef

Timeline for d1yzhb1:

• d1yzhb1 is new in SCOP 1.73
  
• d1yzhb1 appears in SCOP 1.75
  
• d1yzhb1 appears in the current release, SCOPe 2.08, called d1yzhb_