Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.53: TrmB-like [142647] (2 proteins) Pfam PF02390 |
Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142649] (1 PDB entry) Uniprot P67506 8-211 |
Domain d1yzhb_: 1yzh B: [124278] automated match to d1yzha1 complexed with gol |
PDB Entry: 1yzh (more details), 2.02 Å
SCOPe Domain Sequences for d1yzhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzhb_ c.66.1.53 (B:) tRNA (guanine-N(7)-)-methyltransferase TrmB {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} rkgatelleanpqyvvlnpleakakwrdlfgndnpihvevgsgkgafvsgmakqnpdiny igidiqksvlsyaldkvlevgvpnikllwvdgsdltdyfedgeidrlylnfsdpwpkkrh ekrrltyktfldtfkrilpengeihfktdnrglfeyslvsfsqygmklngvwldlhasdf egnvmteyeqkfsnkgqviyrveaef
Timeline for d1yzhb_: