SCOPe 2.08: Domain d1yzhb_: 1yzh B:

Lineage for d1yzhb_ (1yzh B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.53: TrmB-like [142647] (2 proteins)
   Pfam PF02390

6. Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142649] (1 PDB entry)
   Uniprot P67506 8-211

8. Domain d1yzhb_: 1yzh B: [124278]
   automated match to d1yzha1
   complexed with gol

Details for d1yzhb_

PDB Entry: 1yzh, 2.02 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Protein, Methyltransferase from Streptococcus pneumoniae TIGR4

PDB Compounds: (B:) tRNA (guanine-N(7)-)-methyltransferase

SCOPe Domain Sequences for d1yzhb_:

Sequence; same for both SEQRES and ATOM records:

>d1yzhb_ c.66.1.53 (B:) tRNA (guanine-N(7)-)-methyltransferase TrmB {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rkgatelleanpqyvvlnpleakakwrdlfgndnpihvevgsgkgafvsgmakqnpdiny
igidiqksvlsyaldkvlevgvpnikllwvdgsdltdyfedgeidrlylnfsdpwpkkrh
ekrrltyktfldtfkrilpengeihfktdnrglfeyslvsfsqygmklngvwldlhasdf
egnvmteyeqkfsnkgqviyrveaef

Timeline for d1yzhb_:

• d1yzhb_ first appeared in SCOP 1.73, called d1yzhb1
  
• d1yzhb_ appears in SCOPe 2.07