![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.53: TrmB-like [142647] (2 proteins) Pfam PF02390 |
![]() | Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142649] (1 PDB entry) Uniprot P67506 8-211 |
![]() | Domain d1yzha1: 1yzh A:8-211 [124277] complexed with gol |
PDB Entry: 1yzh (more details), 2.02 Å
SCOPe Domain Sequences for d1yzha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} gatelleanpqyvvlnpleakakwrdlfgndnpihvevgsgkgafvsgmakqnpdinyig idiqksvlsyaldkvlevgvpnikllwvdgsdltdyfedgeidrlylnfsdpwpkkrhek rrltyktfldtfkrilpengeihfktdnrglfeyslvsfsqygmklngvwldlhasdfeg nvmteyeqkfsnkgqviyrveaef
Timeline for d1yzha1: