Lineage for d1yzha1 (1yzh A:8-211)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894326Family c.66.1.53: TrmB-like [142647] (2 proteins)
    Pfam PF02390
  6. 2894327Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species)
  7. 2894331Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142649] (1 PDB entry)
    Uniprot P67506 8-211
  8. 2894332Domain d1yzha1: 1yzh A:8-211 [124277]
    complexed with gol

Details for d1yzha1

PDB Entry: 1yzh (more details), 2.02 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Protein, Methyltransferase from Streptococcus pneumoniae TIGR4
PDB Compounds: (A:) tRNA (guanine-N(7)-)-methyltransferase

SCOPe Domain Sequences for d1yzha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gatelleanpqyvvlnpleakakwrdlfgndnpihvevgsgkgafvsgmakqnpdinyig
idiqksvlsyaldkvlevgvpnikllwvdgsdltdyfedgeidrlylnfsdpwpkkrhek
rrltyktfldtfkrilpengeihfktdnrglfeyslvsfsqygmklngvwldlhasdfeg
nvmteyeqkfsnkgqviyrveaef

SCOPe Domain Coordinates for d1yzha1:

Click to download the PDB-style file with coordinates for d1yzha1.
(The format of our PDB-style files is described here.)

Timeline for d1yzha1: