SCOPe 2.06: Domain d1yymq2: 1yym Q:1108-1212

Lineage for d1yymq2 (1yym Q:1108-1212)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1yymq2: 1yym Q:1108-1212 [124239]
   Other proteins in same PDB: d1yymg_, d1yymh1, d1yymh2, d1yyml1, d1yymm1, d1yymp_, d1yymq1, d1yymr1, d1yymr2, d1yyms1
   automatically matched to d1g9ml2
   complexed with edo, ipa, nag, ndg

Details for d1yymq2

PDB Entry: 1yym, 2.2 Å

PDB Description: crystal structure of f23, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b

PDB Compounds: (Q:) Antibody 17B Light chain

SCOPe Domain Sequences for d1yymq2:

Sequence; same for both SEQRES and ATOM records:

>d1yymq2 b.1.1.2 (Q:1108-1212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1yymq2:

• d1yymq2 first appeared in SCOP 1.73
  
• d1yymq2 appears in SCOPe 2.05
  
• d1yymq2 appears in SCOPe 2.07
  
• d1yymq2 appears in the current release, SCOPe 2.08