Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d1yymq2: 1yym Q:1108-1212 [124239] Other proteins in same PDB: d1yymg_, d1yymh1, d1yymh2, d1yyml1, d1yymm1, d1yymp_, d1yymq1, d1yymr1, d1yymr2, d1yyms1 automatically matched to d1g9ml2 complexed with edo, ipa, nag |
PDB Entry: 1yym (more details), 2.2 Å
SCOPe Domain Sequences for d1yymq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yymq2 b.1.1.2 (Q:1108-1212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1yymq2: