SCOPe 2.08: Domain d1yxwa1: 1yxw A:875-1110

Lineage for d1yxwa1 (1yxw A:875-1110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
   automatically mapped to Pfam PF07953

6. Protein Tetanus neurotoxin [49957] (1 species)

7. Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries)

8. Domain d1yxwa1: 1yxw A:875-1110 [124201]
   Other proteins in same PDB: d1yxwa2
   automated match to d1dlla1
   complexed with tyr

Details for d1yxwa1

PDB Entry: 1yxw, 2.2 Å

PDB Description: A common binding site for disialyllactose and a tri-peptide in the C-fragment of tetanus neurotoxin

PDB Compounds: (A:) Tetanus toxin (Tentoxylysin)

SCOPe Domain Sequences for d1yxwa1:

Sequence; same for both SEQRES and ATOM records:

>d1yxwa1 b.29.1.6 (A:875-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls

Timeline for d1yxwa1:

• d1yxwa1 first appeared in SCOP 1.73
  
• d1yxwa1 appears in SCOPe 2.07