![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
![]() | Protein Tetanus neurotoxin [49957] (1 species) |
![]() | Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries) |
![]() | Domain d1yxwa1: 1yxw A:875-1110 [124201] Other proteins in same PDB: d1yxwa2 automated match to d1dlla1 complexed with tyr |
PDB Entry: 1yxw (more details), 2.2 Å
SCOPe Domain Sequences for d1yxwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yxwa1 b.29.1.6 (A:875-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls
Timeline for d1yxwa1: