Lineage for d1yxwa1 (1yxw A:875-1110)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389493Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2389529Protein Tetanus neurotoxin [49957] (1 species)
  7. 2389530Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries)
  8. 2389533Domain d1yxwa1: 1yxw A:875-1110 [124201]
    Other proteins in same PDB: d1yxwa2
    automated match to d1dlla1
    complexed with tyr

Details for d1yxwa1

PDB Entry: 1yxw (more details), 2.2 Å

PDB Description: A common binding site for disialyllactose and a tri-peptide in the C-fragment of tetanus neurotoxin
PDB Compounds: (A:) Tetanus toxin (Tentoxylysin)

SCOPe Domain Sequences for d1yxwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxwa1 b.29.1.6 (A:875-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls

SCOPe Domain Coordinates for d1yxwa1:

Click to download the PDB-style file with coordinates for d1yxwa1.
(The format of our PDB-style files is described here.)

Timeline for d1yxwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yxwa2