Lineage for d1dlla1 (1dll A:875-1110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779820Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2779856Protein Tetanus neurotoxin [49957] (1 species)
  7. 2779857Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries)
  8. 2779859Domain d1dlla1: 1dll A:875-1110 [24263]
    Other proteins in same PDB: d1dlla2
    complexed with gol

Details for d1dlla1

PDB Entry: 1dll (more details), 1.8 Å

PDB Description: the hc fragement of tetanus toxin complexed with lactose
PDB Compounds: (A:) Tetanus toxin

SCOPe Domain Sequences for d1dlla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlla1 b.29.1.6 (A:875-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls

SCOPe Domain Coordinates for d1dlla1:

Click to download the PDB-style file with coordinates for d1dlla1.
(The format of our PDB-style files is described here.)

Timeline for d1dlla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dlla2