Lineage for d1yxra1 (1yxr A:1-77)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696892Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 2696893Family a.7.14.1: MIT domain [116847] (4 proteins)
    Pfam PF04212
    this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain
  6. 2696897Protein Vacuolar protein sorting factor 4a (VPS4A, SKD2) [140352] (1 species)
  7. 2696898Species Human (Homo sapiens) [TaxId:9606] [140353] (1 PDB entry)
    Uniprot Q9UN37 1-77
  8. 2696899Domain d1yxra1: 1yxr A:1-77 [124200]

Details for d1yxra1

PDB Entry: 1yxr (more details)

PDB Description: nmr structure of vps4a mit domain
PDB Compounds: (A:) vacuolar protein sorting factor 4A

SCOPe Domain Sequences for d1yxra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxra1 a.7.14.1 (A:1-77) Vacuolar protein sorting factor 4a (VPS4A, SKD2) {Human (Homo sapiens) [TaxId: 9606]}
mttstlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakc
vqyldraeklkdylrsk

SCOPe Domain Coordinates for d1yxra1:

Click to download the PDB-style file with coordinates for d1yxra1.
(The format of our PDB-style files is described here.)

Timeline for d1yxra1: