Lineage for d1yxra1 (1yxr A:1-77)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636895Superfamily a.7.14: MIT domain [116846] (1 family) (S)
  5. 636896Family a.7.14.1: MIT domain [116847] (3 proteins)
    Pfam PF04212
  6. 636900Protein Vacuolar protein sorting factor 4a (VPS4A, SKD2) [140352] (1 species)
  7. 636901Species Human (Homo sapiens) [TaxId:9606] [140353] (1 PDB entry)
  8. 636902Domain d1yxra1: 1yxr A:1-77 [124200]

Details for d1yxra1

PDB Entry: 1yxr (more details)

PDB Description: NMR Structure of VPS4A MIT Domain
PDB Compounds: (A:) vacuolar protein sorting factor 4A

SCOP Domain Sequences for d1yxra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxra1 a.7.14.1 (A:1-77) Vacuolar protein sorting factor 4a (VPS4A, SKD2) {Human (Homo sapiens) [TaxId: 9606]}
mttstlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakc
vqyldraeklkdylrsk

SCOP Domain Coordinates for d1yxra1:

Click to download the PDB-style file with coordinates for d1yxra1.
(The format of our PDB-style files is described here.)

Timeline for d1yxra1: