Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Peroxisomal trans 2-enoyl CoA reductase [141884] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141885] (1 PDB entry) Uniprot Q9BY49 7-303 |
Domain d1yxmb_: 1yxm B: [124193] automated match to d1yxma1 complexed with ade, po4, so4 |
PDB Entry: 1yxm (more details), 1.9 Å
SCOPe Domain Sequences for d1yxmb_:
Sequence, based on SEQRES records: (download)
>d1yxmb_ c.2.1.2 (B:) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanlp ptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhav letnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslal ewacsgirincvapgviysqtavenygswgqsffegsfqkipakrigvpeevssvvcfll spaasfitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfk
>d1yxmb_ c.2.1.2 (B:) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanlp ptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhav letnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslal ewacsgirincvapgviysqtaqsffegsfqkipakrigvpeevssvvcfllspaasfit gqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfk
Timeline for d1yxmb_: