Lineage for d1yxmb_ (1yxm B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1347622Protein Peroxisomal trans 2-enoyl CoA reductase [141884] (1 species)
  7. 1347623Species Human (Homo sapiens) [TaxId:9606] [141885] (1 PDB entry)
    Uniprot Q9BY49 7-303
  8. 1347625Domain d1yxmb_: 1yxm B: [124193]
    automated match to d1yxma1
    complexed with ade, po4, so4

Details for d1yxmb_

PDB Entry: 1yxm (more details), 1.9 Å

PDB Description: Crystal structure of peroxisomal trans 2-enoyl CoA reductase
PDB Compounds: (B:) peroxisomal trans 2-enoyl CoA reductase

SCOPe Domain Sequences for d1yxmb_:

Sequence, based on SEQRES records: (download)

>d1yxmb_ c.2.1.2 (B:) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanlp
ptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhav
letnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslal
ewacsgirincvapgviysqtavenygswgqsffegsfqkipakrigvpeevssvvcfll
spaasfitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfk

Sequence, based on observed residues (ATOM records): (download)

>d1yxmb_ c.2.1.2 (B:) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanlp
ptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhav
letnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslal
ewacsgirincvapgviysqtaqsffegsfqkipakrigvpeevssvvcfllspaasfit
gqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfk

SCOPe Domain Coordinates for d1yxmb_:

Click to download the PDB-style file with coordinates for d1yxmb_.
(The format of our PDB-style files is described here.)

Timeline for d1yxmb_: