Lineage for d1yxba1 (1yxb A:4-91)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508106Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 1508107Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 1508149Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. 1508150Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)
  7. 1508176Species Streptomyces coelicolor [TaxId:1902] [140799] (1 PDB entry)
    Uniprot Q9EWK0 4-91
  8. 1508177Domain d1yxba1: 1yxb A:4-91 [124175]

Details for d1yxba1

PDB Entry: 1yxb (more details), 2.6 Å

PDB Description: Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8.
PDB Compounds: (A:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d1yxba1:

Sequence, based on SEQRES records: (download)

>d1yxba1 a.204.1.4 (A:4-91) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaae
eisqllyhvqvmmvargislddvyahll

Sequence, based on observed residues (ATOM records): (download)

>d1yxba1 a.204.1.4 (A:4-91) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
llyhvqvmmvargislddvyahll

SCOPe Domain Coordinates for d1yxba1:

Click to download the PDB-style file with coordinates for d1yxba1.
(The format of our PDB-style files is described here.)

Timeline for d1yxba1: